Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT1F 1F protein

This Human MT1F 1F protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MT1F 1F

UniProt

P04733

Expression Region

1-59aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fam171a1 shRNA (UAS) - Lentiviral mouse Fam171a1 shRNA (UAS, GFP) (100)
GTR15114753 1 Vial

Lentiviral mouse Fam171a1 shRNA (UAS) - Lentiviral mouse Fam171a1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
PCMV-SYT7 (human) -3xFLAG-Neo
BZ55547 1 Vial

PCMV-SYT7 (human) -3xFLAG-Neo

Sign In for Pricing
View Details
MIA2 polyclonal antibody
orb1725876-01 50 µL

MIA2 polyclonal antibody

Sign In for Pricing
View Details
MIA2 polyclonal antibody
orb1725876-02 100 µL

MIA2 polyclonal antibody

Sign In for Pricing
View Details
HSPA4L Rabbit Polyclonal Antibody (BF488)
orb2483741 100 µL

HSPA4L Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Recombinant Human GGT5 Protein, N-His
orb2968627-01 50 µg

Recombinant Human GGT5 Protein, N-His

Sign In for Pricing
View Details