Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT1F 1F protein

This Human MT1F 1F protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MT1F 1F

UniProt

P04733

Expression Region

1-59aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOB Fecal Occult Blood Test
GEFOB-602 25 Tests/Box

FOB Fecal Occult Blood Test

Sign In for Pricing
View Details
Mouse Hepatitis Virus, MHV ELISA KIT
ED0096Mo 96 Well

Mouse Hepatitis Virus, MHV ELISA KIT

Sign In for Pricing
View Details
GPR142 Rabbit pAb, AP conjugated
orb2853450 100 µL

GPR142 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
CLK2 Antibody
MBS7121890-01 0.05 mg

CLK2 Antibody

Sign In for Pricing
View Details
CLK2 Antibody
MBS7121890-02 0.1 mg

CLK2 Antibody

Sign In for Pricing
View Details
CLK2 Antibody
MBS7121890-03 5x 0.1 mg

CLK2 Antibody

Sign In for Pricing
View Details