Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpmI protein

This E.coli rpmI protein spans the amino acid sequence from region 7-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpmI, b1717, JW1707

UniProt

P0A7Q1

Expression Region

7-64aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant STAT5A (phospho Y694) Antibody
RC-16804-01 50 μL

Recombinant STAT5A (phospho Y694) Antibody

Sign In for Pricing
View Details
Recombinant STAT5A (phospho Y694) Antibody
RC-16804-02 100 µL

Recombinant STAT5A (phospho Y694) Antibody

Sign In for Pricing
View Details
Recombinant STAT5A (phospho Y694) Antibody
RC-16804-03 1 mL

Recombinant STAT5A (phospho Y694) Antibody

Sign In for Pricing
View Details
D-Mannuronic Acid Sodium Salt
TRC-D208470-250MG 250 mg

D-Mannuronic Acid Sodium Salt

Sign In for Pricing
View Details
Applied Cell Extracellular Matrix
G422 25 mL

Applied Cell Extracellular Matrix

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), 0.2mg/mL
BNUB1813-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), 0.2mg/mL

Sign In for Pricing
View Details