Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpmI protein

This E.coli rpmI protein spans the amino acid sequence from region 7-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpmI, b1717, JW1707

UniProt

P0A7Q1

Expression Region

7-64aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnfrsf21 Mouse Gene Knockout Kit (CRISPR)
KN517985 1 Kit

Tnfrsf21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human HSPB11 Protein (His Tag)
PKSH032522-01 10 µg

Recombinant Human HSPB11 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HSPB11 Protein (His Tag)
PKSH032522-02 50 µg

Recombinant Human HSPB11 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant ZNF252P-AS1 Antibody
RN-13469-01 50 μL

Recombinant ZNF252P-AS1 Antibody

Sign In for Pricing
View Details
Recombinant ZNF252P-AS1 Antibody
RN-13469-02 100 µL

Recombinant ZNF252P-AS1 Antibody

Sign In for Pricing
View Details
Recombinant ZNF252P-AS1 Antibody
RN-13469-03 1 mL

Recombinant ZNF252P-AS1 Antibody

Sign In for Pricing
View Details