Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsM protein

This E.coli rpsM protein spans the amino acid sequence from region 2-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsM, b3298, JW3260

UniProt

P0A7S9

Expression Region

2-118aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADD3 Knockout Raji Polyclonal Cells
ARG21069 1 Million

ADD3 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral mouse Sod1 shRNA (UAS) - Lentiviral mouseSod1 shRNA (UAS, GFP) (25)
GTR15267524 1 Vial

Lentiviral mouse Sod1 shRNA (UAS) - Lentiviral mouseSod1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
NR2C1 Antibody
orb1317890 100 µL

NR2C1 Antibody

Sign In for Pricing
View Details
Rat Protein S100-A9, S100A9 ELISA Kit
MBS1605268-01 48 Well

Rat Protein S100-A9, S100A9 ELISA Kit

Sign In for Pricing
View Details
Rat Protein S100-A9, S100A9 ELISA Kit
MBS1605268-02 96 Well

Rat Protein S100-A9, S100A9 ELISA Kit

Sign In for Pricing
View Details
Rat Protein S100-A9, S100A9 ELISA Kit
MBS1605268-03 5x 96 Well

Rat Protein S100-A9, S100A9 ELISA Kit

Sign In for Pricing
View Details