Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MMP9 protein

This Human MMP9 protein spans the amino acid sequence from region 107-707aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLG 4B, CLG4B, Collagenase Type 4 beta, Collagenase type IV 92 KD, EC 3.4.24.35, Gelatinase 92 KD, Gelatinase B, Gelatinase beta, GelatinaseB, GELB, Macrophage gelatinase, MANDP2

UniProt

P14780

Expression Region

107-707aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF594 conjugate, 0.1mg/mL
BNC941950-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRP1 (TYRP1) (NM_000550) Human Over-expression Lysate
LC400187 20 µg

TRP1 (TYRP1) (NM_000550) Human Over-expression Lysate

Sign In for Pricing
View Details
PGAM4 (NM_001029891) Human Over-expression Lysate
LY422267 100 µg

PGAM4 (NM_001029891) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope Protein Monoclonal Antibody
E-AB-V1331-01 20 µL

Anti-Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope Protein Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope Protein Monoclonal Antibody
E-AB-V1331-02 100 µL

Anti-Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope Protein Monoclonal Antibody

Sign In for Pricing
View Details
Human CAPSL activation kit by CRISPRa
GA115207 1 Kit

Human CAPSL activation kit by CRISPRa

Sign In for Pricing
View Details