E.coli rpsR protein
This E.coli rpsR protein spans the amino acid sequence from region 2-75aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
RpsR, b4202, JW4160
UniProt
P0A7T7
Expression Region
2-75aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is GST-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRHQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2484345 100 µL
Glutamate receptor 3 Rabbit Polyclonal Antibody (BF680)
Sign In for Pricing
View Details orb2617182 100 µg
FSH Receptor/FSHR Rabbit Polyclonal Antibody (HRP)
Sign In for Pricing
View Details 
MBS7219260-01 48 Well
Rabbit Nudeotide Binding Digomerzation Domain 2 ELISA Kit
Sign In for Pricing
View Details MBS7219260-02 96 Well
Rabbit Nudeotide Binding Digomerzation Domain 2 ELISA Kit
Sign In for Pricing
View Details MBS7219260-03 5x 96 Well
Rabbit Nudeotide Binding Digomerzation Domain 2 ELISA Kit
Sign In for Pricing
View Details MBS7219260-04 10x 96 Well
Rabbit Nudeotide Binding Digomerzation Domain 2 ELISA Kit
Sign In for Pricing
View Details