Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mmp2 protein

This Rat Mmp2 protein spans the amino acid sequence from region 110-662aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mmp2

UniProt

P33436

Expression Region

110-662aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TTC11 Antibody [Alexa Fluor 700]
NBP2-97168AF700 0.1 mL

Rabbit Polyclonal TTC11 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Morpholin-4-ylcarbonyl chloride
OR8831-01 5 g

Morpholin-4-ylcarbonyl chloride

Sign In for Pricing
View Details
Morpholin-4-ylcarbonyl chloride
OR8831-02 25 g

Morpholin-4-ylcarbonyl chloride

Sign In for Pricing
View Details
Morpholin-4-ylcarbonyl chloride
OR8831-03 2.5 Kg

Morpholin-4-ylcarbonyl chloride

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to ZP2
E10-32421 100 µL

Mouse Monoclonal Antibody to ZP2

Sign In for Pricing
View Details
Zfp36l1 (NM_007564) Mouse Tagged ORF Clone Lentiviral Particle
MR205035L3V 200 µL

Zfp36l1 (NM_007564) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details