Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsS protein

This E.coli rpsS protein spans the amino acid sequence from region 2-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsS, b3316, JW3278

UniProt

P0A7U3

Expression Region

2-92aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Aloxe3 shRNA (UAS) - Lentiviral mouse Aloxe3 shRNA (UAS) (25)
GTR15180065 1 Vial

Lentiviral mouse Aloxe3 shRNA (UAS) - Lentiviral mouse Aloxe3 shRNA (UAS) (25)

Sign In for Pricing
View Details
CLN8 Protein Lysate (Human) with C-Ha Tag
16363031 100 µg

CLN8 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rabbit Polyclonal MTERFD2 Antibody [Alexa Fluor 594]
NBP2-81966AF594 0.1 mL

Rabbit Polyclonal MTERFD2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
HHATL Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-12315R-BF594 100 µL

HHATL Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Adrm1 Mouse shRNA Plasmid (Locus ID 56436)
TL503194 1 Kit

Adrm1 Mouse shRNA Plasmid (Locus ID 56436)

Sign In for Pricing
View Details
Gkap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
21565116 3x 1.0 µg

Gkap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details