Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsS protein

This E.coli rpsS protein spans the amino acid sequence from region 2-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsS, b3316, JW3278

UniProt

P0A7U3

Expression Region

2-92aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRN (NM_002846) Human Recombinant Protein
TP721211XL 1 mg

PTPRN (NM_002846) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CALML5/CLSP Protein (His & GST Tag)
PKSH031003 100 µg

Recombinant Human CALML5/CLSP Protein (His & GST Tag)

Sign In for Pricing
View Details
CYTSA, NT (SPECC1L, CYTSA, KIAA0376, Cytospin-A, Renal carcinoma antigen NY-REN-22, Sperm antigen with calponin homology and coiled-coil domains 1-like) (MaxLight 650) discontinued
034448-ML650 100 µL

CYTSA, NT (SPECC1L, CYTSA, KIAA0376, Cytospin-A, Renal carcinoma antigen NY-REN-22, Sperm antigen with calponin homology and coiled-coil domains 1-like) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Boc-Asn-ol
A6609-100000 100 g

Boc-Asn-ol

Sign In for Pricing
View Details
SPAM1 Protein, Human, Recombinant (His)
TMPH-01509-01 5 µg

SPAM1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
SPAM1 Protein, Human, Recombinant (His)
TMPH-01509-02 10 µg

SPAM1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details