Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsC protein

This E.coli rpsC protein spans the amino acid sequence from region 2-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsC, b3314, JW3276

UniProt

P0A7V3

Expression Region

2-233aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cox7c ELISA KIT
ELI-32367m 96 Tests

Mouse Cox7c ELISA KIT

Sign In for Pricing
View Details
Recombinant Human IKZF3
P9649-01 50 µg

Recombinant Human IKZF3

Sign In for Pricing
View Details
Recombinant Human IKZF3
P9649-02 200 µg

Recombinant Human IKZF3

Sign In for Pricing
View Details
Recombinant Human IKZF3
P9649-03 1 mg

Recombinant Human IKZF3

Sign In for Pricing
View Details
PBX2 (NM_002586) Human Recombinant Protein
TP310250M 100 µg

PBX2 (NM_002586) Human Recombinant Protein

Sign In for Pricing
View Details
Tenascin C (TNC) Recombinant, Rat
156966-01 10 µg

Tenascin C (TNC) Recombinant, Rat

Sign In for Pricing
View Details