Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsC protein

This E.coli rpsC protein spans the amino acid sequence from region 2-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsC, b3314, JW3276

UniProt

P0A7V3

Expression Region

2-233aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5L Rabbit pAb
orb2718123-01 50 µL

CD5L Rabbit pAb

Sign In for Pricing
View Details
CD5L Rabbit pAb
orb2718123-02 100 µL

CD5L Rabbit pAb

Sign In for Pricing
View Details
Recombinant Mouse Cytochrome P450 19A1 (Cyp19a1)
MBS962405-01 0.02 mg (E-Coli)

Recombinant Mouse Cytochrome P450 19A1 (Cyp19a1)

Sign In for Pricing
View Details
Recombinant Mouse Cytochrome P450 19A1 (Cyp19a1)
MBS962405-02 0.02 mg (Yeast)

Recombinant Mouse Cytochrome P450 19A1 (Cyp19a1)

Sign In for Pricing
View Details
Recombinant Mouse Cytochrome P450 19A1 (Cyp19a1)
MBS962405-03 0.1 mg (E-Coli)

Recombinant Mouse Cytochrome P450 19A1 (Cyp19a1)

Sign In for Pricing
View Details
Recombinant Mouse Cytochrome P450 19A1 (Cyp19a1)
MBS962405-04 0.1 mg (Yeast)

Recombinant Mouse Cytochrome P450 19A1 (Cyp19a1)

Sign In for Pricing
View Details