Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsF protein

This E.coli rpsF protein spans the amino acid sequence from region 1-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsF, b4200, JW4158

UniProt

P02358

Expression Region

1-131aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TPMT Antibody Picoband® (Carrier-free Conjugate)
A00671-1-carrier-free 100 µg/Vial

Anti-TPMT Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
L-Glutamine-15N
TRC-G597303-10MG 10 mg

L-Glutamine-15N

Sign In for Pricing
View Details
Diisopropyl azodicarboxylate
JH661325 1 Each

Diisopropyl azodicarboxylate

Sign In for Pricing
View Details
Sheep Alba-like protein C9orf23 (C9orf23) ELISA Kit
MBS7237630-01 48 Well

Sheep Alba-like protein C9orf23 (C9orf23) ELISA Kit

Sign In for Pricing
View Details
Sheep Alba-like protein C9orf23 (C9orf23) ELISA Kit
MBS7237630-02 96 Well

Sheep Alba-like protein C9orf23 (C9orf23) ELISA Kit

Sign In for Pricing
View Details
Sheep Alba-like protein C9orf23 (C9orf23) ELISA Kit
MBS7237630-03 5x 96 Well

Sheep Alba-like protein C9orf23 (C9orf23) ELISA Kit

Sign In for Pricing
View Details