Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsF protein

This E.coli rpsF protein spans the amino acid sequence from region 1-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsF, b4200, JW4158

UniProt

P02358

Expression Region

1-131aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GTPBP4 Antibody
CQA3024-01 30 µL

Anti-GTPBP4 Antibody

Sign In for Pricing
View Details
Anti-GTPBP4 Antibody
CQA3024-02 50 μL

Anti-GTPBP4 Antibody

Sign In for Pricing
View Details
Anti-GTPBP4 Antibody
CQA3024-03 100 µL

Anti-GTPBP4 Antibody

Sign In for Pricing
View Details
Anti-GTPBP4 Antibody
CQA3024-04 200 µL

Anti-GTPBP4 Antibody

Sign In for Pricing
View Details
2,10-diaza-9- (2-chlorophenyl) -5-phenyltricyclo[9.4.0.0<3,8>]pentadeca-1 (15),3 (8),11 (12),13-tetraen-7-one
YLA68812 250 mg

2,10-diaza-9- (2-chlorophenyl) -5-phenyltricyclo[9.4.0.0<3,8>]pentadeca-1 (15),3 (8),11 (12),13-tetraen-7-one

Sign In for Pricing
View Details
Mouse Monoclonal POGZ Antibody (PCRP-POGZ-1B2) [Biotin]
NBP3-24195B 0.1 mL

Mouse Monoclonal POGZ Antibody (PCRP-POGZ-1B2) [Biotin]

Sign In for Pricing
View Details