Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpsF protein

This E.coli rpsF protein spans the amino acid sequence from region 1-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpsF, b4200, JW4158

UniProt

P02358

Expression Region

1-131aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2C (Ubiquitin-conjugating Enzyme E2C, UBCH10, dJ447F3.2) (Biotin)
MBS6173351-01 0.1 mL

UBE2C (Ubiquitin-conjugating Enzyme E2C, UBCH10, dJ447F3.2) (Biotin)

Sign In for Pricing
View Details
UBE2C (Ubiquitin-conjugating Enzyme E2C, UBCH10, dJ447F3.2) (Biotin)
MBS6173351-02 5x 0.1 mL

UBE2C (Ubiquitin-conjugating Enzyme E2C, UBCH10, dJ447F3.2) (Biotin)

Sign In for Pricing
View Details
Ketohypoglycin
orb1909153 25 mg

Ketohypoglycin

Sign In for Pricing
View Details
TIAR Lentiviral Activation Particles (m2)
sc-423392-LAC-2 200 µL

TIAR Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
SIAH1, ID (SIAH1, HUMSIAH, E3 ubiquitin-protein ligase SIAH1, Seven in absentia homolog 1, Siah-1a) (MaxLight 750) discontinued
041727-ML750 100 µL

SIAH1, ID (SIAH1, HUMSIAH, E3 ubiquitin-protein ligase SIAH1, Seven in absentia homolog 1, Siah-1a) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CXCL16 (h) -PR
sc-105252-PR 10 µM - 20 µL

CXCL16 (h) -PR

Sign In for Pricing
View Details