Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6G6D protein

This Human LY6G6D protein spans the amino acid sequence from region 20-104aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LY6G6D

UniProt

O95868

Expression Region

20-104aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 2.816-3.741 ng/mL.

Form

Lyophilized powder

Molecular Weight

11.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IgG2c Antibody Pair Set
E-KAB-0632 50 µL & 100 µg

Rat IgG2c Antibody Pair Set

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF405S conjugate, 0.1mg/mL
BNC042259-100 1x 100 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dematin (DMTN) (NM_001114136) Human Recombinant Protein
TP325631L 1 mg

Dematin (DMTN) (NM_001114136) Human Recombinant Protein

Sign In for Pricing
View Details
FTSJD2 (CMTR1) (NM_015050) Human Recombinant Protein
TP305762M 100 µg

FTSJD2 (CMTR1) (NM_015050) Human Recombinant Protein

Sign In for Pricing
View Details
Class A basic helix loop helix protein 9 (BHLHA9) Rabbit Polyclonal Antibody
TA368007 100 µL

Class A basic helix loop helix protein 9 (BHLHA9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C10orf7 (CDC123) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B9]
TA505682AM 100 µL

C10orf7 (CDC123) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B9]

Sign In for Pricing
View Details