Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6G6D protein

This Human LY6G6D protein spans the amino acid sequence from region 20-104aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LY6G6D

UniProt

O95868

Expression Region

20-104aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 2.816-3.741 ng/mL.

Form

Lyophilized powder

Molecular Weight

11.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EZH2 Rabbit Polyclonal Antibody
TA368948 100 µL

EZH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPAIN Mouse Monoclonal Antibody [Clone ID: OTI4A9]
CF810599 100 µg

RPAIN Mouse Monoclonal Antibody [Clone ID: OTI4A9]

Sign In for Pricing
View Details
Human TM4SF5 activation kit by CRISPRa
GA106003 1 Kit

Human TM4SF5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560865 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Recombinant UFM1 Antibody
RC-4088-01 50 μL

Recombinant UFM1 Antibody

Sign In for Pricing
View Details
Recombinant UFM1 Antibody
RC-4088-02 100 µL

Recombinant UFM1 Antibody

Sign In for Pricing
View Details