Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RELT protein

This Human RELT protein spans the amino acid sequence from region 26-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RELT

UniProt

Q969Z4

Expression Region

26-153aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEPDC1B, CT (DEPDC1B, XTP8, DEP domain-containing protein 1B, HBV X-transactivated gene 8 protein, HBV XAg-transactivated protein 8) (MaxLight 550)
MBS6291757-01 0.1 mL

DEPDC1B, CT (DEPDC1B, XTP8, DEP domain-containing protein 1B, HBV X-transactivated gene 8 protein, HBV XAg-transactivated protein 8) (MaxLight 550)

Sign In for Pricing
View Details
DEPDC1B, CT (DEPDC1B, XTP8, DEP domain-containing protein 1B, HBV X-transactivated gene 8 protein, HBV XAg-transactivated protein 8) (MaxLight 550)
MBS6291757-02 5x 0.1 mL

DEPDC1B, CT (DEPDC1B, XTP8, DEP domain-containing protein 1B, HBV X-transactivated gene 8 protein, HBV XAg-transactivated protein 8) (MaxLight 550)

Sign In for Pricing
View Details
SERPINB2 Antibody
orb1177366 100 µg

SERPINB2 Antibody

Sign In for Pricing
View Details
(3β,5β) -3-Hydroxycholan-24-oic acid
428302-01 50 mg

(3β,5β) -3-Hydroxycholan-24-oic acid

Sign In for Pricing
View Details
(3β,5β) -3-Hydroxycholan-24-oic acid
428302-02 250 mg

(3β,5β) -3-Hydroxycholan-24-oic acid

Sign In for Pricing
View Details
SNCA Recombinant Monoclonal Antibody
CSB-RA021912MA1HU-01 50 μL

SNCA Recombinant Monoclonal Antibody

Sign In for Pricing
View Details