Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RELT protein

This Human RELT protein spans the amino acid sequence from region 26-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RELT

UniProt

Q969Z4

Expression Region

26-153aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEL1L Antibody
55-340 400 µL

SEL1L Antibody

Sign In for Pricing
View Details
AFG3L2 Rabbit pAb, PE-Cy5 conjugated
orb2867427 100 µL

AFG3L2 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Secretagogin, EF-Hand Calcium Binding Protein (SCGN) Antibody (Biotin)
abx305242-01 20 µg

Secretagogin, EF-Hand Calcium Binding Protein (SCGN) Antibody (Biotin)

Sign In for Pricing
View Details
Secretagogin, EF-Hand Calcium Binding Protein (SCGN) Antibody (Biotin)
abx305242-02 50 µg

Secretagogin, EF-Hand Calcium Binding Protein (SCGN) Antibody (Biotin)

Sign In for Pricing
View Details
Secretagogin, EF-Hand Calcium Binding Protein (SCGN) Antibody (Biotin)
abx305242-03 100 µg

Secretagogin, EF-Hand Calcium Binding Protein (SCGN) Antibody (Biotin)

Sign In for Pricing
View Details
Secretagogin, EF-Hand Calcium Binding Protein (SCGN) Antibody (Biotin)
abx305242-04 200 µg

Secretagogin, EF-Hand Calcium Binding Protein (SCGN) Antibody (Biotin)

Sign In for Pricing
View Details