Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RELT protein

This Human RELT protein spans the amino acid sequence from region 26-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RELT

UniProt

Q969Z4

Expression Region

26-153aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf34 (CCDC178) (NM_198995) Human Tagged Lenti ORF Clone
RC216329L4 10 µg

C18orf34 (CCDC178) (NM_198995) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Alexa Fluor® 532-conjugated Rabbit Anti-Rat IgG H&L
HY-P89220 1 Each

Alexa Fluor® 532-conjugated Rabbit Anti-Rat IgG H&L

Sign In for Pricing
View Details
MYST1 (Probable Histone Acetyltransferase MYST1, MYST Protein 1, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 1, hMOF, HMOF, MOF, PP7073, FLJ14040) (Biotin)
MBS6386404-01 0.1 mL

MYST1 (Probable Histone Acetyltransferase MYST1, MYST Protein 1, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 1, hMOF, HMOF, MOF, PP7073, FLJ14040) (Biotin)

Sign In for Pricing
View Details
MYST1 (Probable Histone Acetyltransferase MYST1, MYST Protein 1, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 1, hMOF, HMOF, MOF, PP7073, FLJ14040) (Biotin)
MBS6386404-02 5x 0.1 mL

MYST1 (Probable Histone Acetyltransferase MYST1, MYST Protein 1, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 1, hMOF, HMOF, MOF, PP7073, FLJ14040) (Biotin)

Sign In for Pricing
View Details
OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (HRP)
249684-HRP 100 µL

OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (HRP)

Sign In for Pricing
View Details
GABAA Rα2 shRNA Plasmid (m)
sc-42428-SH 20 µg

GABAA Rα2 shRNA Plasmid (m)

Sign In for Pricing
View Details