Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Klkb1 protein

This Rat Klkb1 protein spans the amino acid sequence from region 391-638aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Klkb1

UniProt

P14272

Expression Region

391-638aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IQCH activation kit by CRISPRa
GA112156 1 Kit

Human IQCH activation kit by CRISPRa

Sign In for Pricing
View Details
Mini Sample Mouse Cys-C (Cystatin C) ELISA Kit
E-MSEL-M0068-01 24 Tests

Mini Sample Mouse Cys-C (Cystatin C) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse Cys-C (Cystatin C) ELISA Kit
E-MSEL-M0068-02 48 Tests

Mini Sample Mouse Cys-C (Cystatin C) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse Cys-C (Cystatin C) ELISA Kit
E-MSEL-M0068-03 96 Tests

Mini Sample Mouse Cys-C (Cystatin C) ELISA Kit

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF740 conjugate, 0.1mg/mL
BNC742259-100 1x 100 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCAS3 (NM_017679) Human Recombinant Protein
TP317085 20 µg

BCAS3 (NM_017679) Human Recombinant Protein

Sign In for Pricing
View Details