Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD137L protein

This Human CD137L protein spans the amino acid sequence from region 52-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD137L, TNFSF9, 4-1BBL

UniProt

P41273

Expression Region

52-254aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERINC3 Rabbit pAb
orb2717993-01 50 µL

SERINC3 Rabbit pAb

Sign In for Pricing
View Details
SERINC3 Rabbit pAb
orb2717993-02 100 µL

SERINC3 Rabbit pAb

Sign In for Pricing
View Details
HELLS Protein Vector (Mouse) (pPM-C-HA)
PV188356 500 ng

HELLS Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human ETRA (Endothelin Receptor A) ELISA Kit
MBS8802034-01 48 Well

Human ETRA (Endothelin Receptor A) ELISA Kit

Sign In for Pricing
View Details
Human ETRA (Endothelin Receptor A) ELISA Kit
MBS8802034-02 96 Well

Human ETRA (Endothelin Receptor A) ELISA Kit

Sign In for Pricing
View Details
Human ETRA (Endothelin Receptor A) ELISA Kit
MBS8802034-03 5x 96 Well

Human ETRA (Endothelin Receptor A) ELISA Kit

Sign In for Pricing
View Details