Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD137L protein

This Human CD137L protein spans the amino acid sequence from region 52-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD137L, TNFSF9, 4-1BBL

UniProt

P41273

Expression Region

52-254aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 550)
MBS6378863-01 0.1 mL

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 550)

Sign In for Pricing
View Details
FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 550)
MBS6378863-02 5x 0.1 mL

FOXJ1 (Forkhead Box Protein J1, Forkhead-related Protein FKHL13, Hepatocyte Nuclear Factor 3 Forkhead Homolog 4, HFH-4, FKHL13, HFH4) (MaxLight 550)

Sign In for Pricing
View Details
DDX34 CRISPR/Cas9 KO Plasmid (m)
sc-428025 20 µg

DDX34 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Recombinant Solanum lycopersicum Photosystem II reaction center protein I (psbI), partial
MBS7076751 Inquire

Recombinant Solanum lycopersicum Photosystem II reaction center protein I (psbI), partial

Sign In for Pricing
View Details
Rabbit Metallothionein 3 ELISA kit
GTR10462731 96 Well

Rabbit Metallothionein 3 ELISA kit

Sign In for Pricing
View Details
OR4A5 Polyclonal Antibody
RA33836-01 50 µL

OR4A5 Polyclonal Antibody

Sign In for Pricing
View Details