Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLK7 protein

This Human KLK7 protein spans the amino acid sequence from region 28-253aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KLK7, PRSS6, SCCE

UniProt

P49862

Expression Region

28-253aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Propionyl-Histone H3 (Lys18) Antibody (2K865)
TMAB-11783-01 50 μL

Anti-Propionyl-Histone H3 (Lys18) Antibody (2K865)

Sign In for Pricing
View Details
Anti-Propionyl-Histone H3 (Lys18) Antibody (2K865)
TMAB-11783-02 100 µL

Anti-Propionyl-Histone H3 (Lys18) Antibody (2K865)

Sign In for Pricing
View Details
Calpain 2 HDR Plasmid (h2)
sc-401113-HDR-2 20 µg

Calpain 2 HDR Plasmid (h2)

Sign In for Pricing
View Details
Active Bovine Superoxide Dismutase (SOD), High Purity >95%
CED026 30 KU

Active Bovine Superoxide Dismutase (SOD), High Purity >95%

Sign In for Pricing
View Details
Nxt2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32373114 3x 1.0 µg

Nxt2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Caspase 7 (CASP7) CLIA Kit
abx196507-01 96 Tests

Human Caspase 7 (CASP7) CLIA Kit

Sign In for Pricing
View Details