Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCND2 protein

This Human KCND2 protein spans the amino acid sequence from region 406-630aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KCND2, KIAA1044

UniProt

Q9NZV8

Expression Region

406-630aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Horse IgG H&L Secondary Antibody
TMAB-02018-01 1 mg

Rabbit Anti-Horse IgG H&L Secondary Antibody

Sign In for Pricing
View Details
Rabbit Anti-Horse IgG H&L Secondary Antibody
TMAB-02018-02 10 mg

Rabbit Anti-Horse IgG H&L Secondary Antibody

Sign In for Pricing
View Details
SLC25A23 Rabbit Polyclonal Antibody
TA361669 100 µL

SLC25A23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae CLB5 Protein (aa 1-435) [His]
VAng-Wyb4410-1mg 1 mg

Recombinant Saccharomyces Cerevisiae CLB5 Protein (aa 1-435) [His]

Sign In for Pricing
View Details
Shb CRISPR/Cas9 KO Plasmid (m)
sc-432924 20 µg

Shb CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Cadherin-23 Overexpression Lysate (Native) - (Dry Ice)
NBP2-05857 0.1 mg

Cadherin-23 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details