Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCND1 protein

This Human KCND1 protein spans the amino acid sequence from region 410-647aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KCND1

UniProt

Q9NSA2

Expression Region

410-647aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGF Receptor Antibody (phospho-Y1172)
F48508-0.08ML 0.08 mL

EGF Receptor Antibody (phospho-Y1172)

Sign In for Pricing
View Details
Mouse APOE (Apolipoprotein E) CLIA Kit
E-CL-M0101-01 24 Tests

Mouse APOE (Apolipoprotein E) CLIA Kit

Sign In for Pricing
View Details
Mouse APOE (Apolipoprotein E) CLIA Kit
E-CL-M0101-02 48 Tests

Mouse APOE (Apolipoprotein E) CLIA Kit

Sign In for Pricing
View Details
Mouse APOE (Apolipoprotein E) CLIA Kit
E-CL-M0101-03 96 Tests

Mouse APOE (Apolipoprotein E) CLIA Kit

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/2940R), CF740 conjugate, 0.1mg/mL
BNC742940-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/2940R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF594 conjugate, 0.1mg/mL
BNC940810-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details