Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ITGAV protein

This Human ITGAV protein spans the amino acid sequence from region 891-1048aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ITGAV

UniProt

P06756

Expression Region

891-1048aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rubisco Polyclonal Antibody
JOT-AP13966-01 20 µL

Rubisco Polyclonal Antibody

Sign In for Pricing
View Details
Rubisco Polyclonal Antibody
JOT-AP13966-02 50 μL

Rubisco Polyclonal Antibody

Sign In for Pricing
View Details
Rubisco Polyclonal Antibody
JOT-AP13966-03 100 µL

Rubisco Polyclonal Antibody

Sign In for Pricing
View Details
Chordin Rabbit Polyclonal Antibody
orb156357-01 50 μL

Chordin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chordin Rabbit Polyclonal Antibody
orb156357-02 100 µL

Chordin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chordin Rabbit Polyclonal Antibody
orb156357-03 200 µL

Chordin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details