Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il2rb protein

This Mouse Il2rb protein spans the amino acid sequence from region 27-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Il2rb

UniProt

P16297

Expression Region

27-240aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NEU4
orb1098900-01 50 µg

Recombinant Human NEU4

Sign In for Pricing
View Details
Recombinant Human NEU4
orb1098900-02 100 µg

Recombinant Human NEU4

Sign In for Pricing
View Details
Recombinant Human NEU4
orb1098900-03 200 µg

Recombinant Human NEU4

Sign In for Pricing
View Details
Recombinant Human NEU4
orb1098900-04 1 mg

Recombinant Human NEU4

Sign In for Pricing
View Details
SLX4/BTBD12 Rabbit Polyclonal Antibody (BF594)
orb2457963 100 µL

SLX4/BTBD12 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
DCK Protein Vector (Mouse) (pPB-N-His)
PV170743 500 ng

DCK Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details