Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il2rb protein

This Mouse Il2rb protein spans the amino acid sequence from region 27-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Il2rb

UniProt

P16297

Expression Region

27-240aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM38A Protein Vector (Human) (pPB-N-His)
PV015362 500 ng

FAM38A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PTBP1 3'UTR GFP Stable Cell Line
TU069122 1.0 mL

PTBP1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Caspase-8 subunit p18 Rabbit pAb, BF700 conjugated
orb2863171 100 µL

Caspase-8 subunit p18 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
RN5S38 Protein Vector (Human) (pPB-N-His)
PV117163 500 ng

RN5S38 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Dom3z 3'UTR GFP Stable Cell Line
TU253585 1.0 mL

Dom3z 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FAK Polyclonal Antibody
MBS2535336-01 0.02 mL

FAK Polyclonal Antibody

Sign In for Pricing
View Details