Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit Il17a protein

This Rabbit Il17a protein spans the amino acid sequence from region 21-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Il17a Ctla8 Il17

UniProt

G1SLF2

Expression Region

21-153aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SASH1 Knockout HEK293T cell line
GTR15404559 1 Vial

Human SASH1 Knockout HEK293T cell line

Sign In for Pricing
View Details
PACS2 (Phosphofurin Acidic Cluster Sorting Protein 2, PACS-2, PACS1-like Protein, PACS1L)
352419 100 µg

PACS2 (Phosphofurin Acidic Cluster Sorting Protein 2, PACS-2, PACS1-like Protein, PACS1L)

Sign In for Pricing
View Details
ACR Recombinant Protein (Mouse)
RP113924 100 µg

ACR Recombinant Protein (Mouse)

Sign In for Pricing
View Details
PLV3-U6-HMGCS2-shRNA1-CopGFP-Puro Plasmid
PVT66162 2 µg

PLV3-U6-HMGCS2-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Zimbirelimab Biosimilar (Monoclonal, IgG4-lambda)
A135466 100 µL

Zimbirelimab Biosimilar (Monoclonal, IgG4-lambda)

Sign In for Pricing
View Details
1-Fluoro-3,5-dimethoxybenzene
FF70111-01 50 g

1-Fluoro-3,5-dimethoxybenzene

Sign In for Pricing
View Details