Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast IL10 protein

This Yeast IL10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL10

UniProt

P51496

Expression Region

19-178aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ipo8 shRNA (UAS) - Lentiviral mouse Ipo8 shRNA (UAS, iRFP) plasmid
GTR15238252 1 Vial

Lentiviral mouse Ipo8 shRNA (UAS) - Lentiviral mouse Ipo8 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SIGLEC9 Protein Lysate
OCOA02117-20UG 20 µg

SIGLEC9 Protein Lysate

Sign In for Pricing
View Details
CTLA-4 (h) -PR
sc-42766-PR 10 µM - 20 µL

CTLA-4 (h) -PR

Sign In for Pricing
View Details
Recombinant Pig 4-aminobutyrate aminotransferase, mitochondrial (ABAT)
MBS960807-01 0.02 mg (E-Coli)

Recombinant Pig 4-aminobutyrate aminotransferase, mitochondrial (ABAT)

Sign In for Pricing
View Details
Recombinant Pig 4-aminobutyrate aminotransferase, mitochondrial (ABAT)
MBS960807-02 0.02 mg (Yeast)

Recombinant Pig 4-aminobutyrate aminotransferase, mitochondrial (ABAT)

Sign In for Pricing
View Details
Recombinant Pig 4-aminobutyrate aminotransferase, mitochondrial (ABAT)
MBS960807-03 0.1 mg (E-Coli)

Recombinant Pig 4-aminobutyrate aminotransferase, mitochondrial (ABAT)

Sign In for Pricing
View Details