Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL10 protein

This Bovine IL10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL10

UniProt

P43480

Expression Region

19-178aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRDASTLSDSSCIHLPTSLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Polyclonal Antibody, Cy7 Conjugated
bs-43560R-Cy7 100 µL

EGFR Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Pefloxacin 30 µg
9314 5x 50 Discs

Pefloxacin 30 µg

Sign In for Pricing
View Details
RNF45 Rabbit pAb, BF700 conjugated
orb2882426 100 µL

RNF45 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
CLEARLock Microtube PP w Cap 1.5mL - St.
TUB1044 100 / PCK

CLEARLock Microtube PP w Cap 1.5mL - St.

Sign In for Pricing
View Details
COD Thermoreactor
LE-CT101 1 Unit

COD Thermoreactor

Sign In for Pricing
View Details
ErbB-2/HER2 MBlocking Peptide
MBS9620329-01 1 mg

ErbB-2/HER2 MBlocking Peptide

Sign In for Pricing
View Details