Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL10 protein

This Bovine IL10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL10

UniProt

P43480

Expression Region

19-178aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRDASTLSDSSCIHLPTSLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSPS (SULT1A3) Mouse Monoclonal Antibody [Clone ID: LBI5E9]
AMM20052VCF 100 µg

CSPS (SULT1A3) Mouse Monoclonal Antibody [Clone ID: LBI5E9]

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf66 (C17orf66)
MBS1225727-01 0.02 mg (E-Coli)

Recombinant Human Uncharacterized protein C17orf66 (C17orf66)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf66 (C17orf66)
MBS1225727-02 0.02 mg (Yeast)

Recombinant Human Uncharacterized protein C17orf66 (C17orf66)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf66 (C17orf66)
MBS1225727-03 0.1 mg (E-Coli)

Recombinant Human Uncharacterized protein C17orf66 (C17orf66)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf66 (C17orf66)
MBS1225727-04 0.1 mg (Yeast)

Recombinant Human Uncharacterized protein C17orf66 (C17orf66)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf66 (C17orf66)
MBS1225727-05 0.02 mg (Baculovirus)

Recombinant Human Uncharacterized protein C17orf66 (C17orf66)

Sign In for Pricing
View Details