Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Thpo protein

This Rat Thpo protein spans the amino acid sequence from region 22-194. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thpo, Thrombopoietin

UniProt

P49745

Expression Region

22-194

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Olfactory receptor 8J3 Antibody
A17588 100 µL

Anti-Olfactory receptor 8J3 Antibody

Sign In for Pricing
View Details
AKR1D1 Polyclonal Antibody
A72331-100 100 µL

AKR1D1 Polyclonal Antibody

Sign In for Pricing
View Details
OGDH Protein Lysate (Human) with C-Ha Tag
32477032 100 µg

OGDH Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Mouse Cyp51 qPCR Primer Pair
QM11878S 200 Tests

Mouse Cyp51 qPCR Primer Pair

Sign In for Pricing
View Details
TMEM192 Recombinant Rabbit mAb
BS46226-01 50 µL

TMEM192 Recombinant Rabbit mAb

Sign In for Pricing
View Details
TMEM192 Recombinant Rabbit mAb
BS46226-02 100 µL

TMEM192 Recombinant Rabbit mAb

Sign In for Pricing
View Details