Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IFNG protein

This Sheep IFNG protein spans the amino acid sequence from region 24-166a. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFNG

UniProt

P17773

Expression Region

24-166a

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL22 Rabbit Polyclonal Antibody (BF594)
orb2503787 100 µL

FBXL22 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
1-Cyclopropyl-2-methyl-1H-pyrrole-3-carboxylic acid
ZJC52027-01 50 mg

1-Cyclopropyl-2-methyl-1H-pyrrole-3-carboxylic acid

Sign In for Pricing
View Details
1-Cyclopropyl-2-methyl-1H-pyrrole-3-carboxylic acid
ZJC52027-02 0.5 g

1-Cyclopropyl-2-methyl-1H-pyrrole-3-carboxylic acid

Sign In for Pricing
View Details
RGD1306622 3'UTR Luciferase Stable Cell Line
TU217654 1.0 mL

RGD1306622 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Uncharacterized protein C05B5.2 (C05B5.2)
MBS7040932-01 0.02 mg

Recombinant Uncharacterized protein C05B5.2 (C05B5.2)

Sign In for Pricing
View Details
Recombinant Uncharacterized protein C05B5.2 (C05B5.2)
MBS7040932-02 0.1 mg

Recombinant Uncharacterized protein C05B5.2 (C05B5.2)

Sign In for Pricing
View Details