Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFI6 protein

This Human IFI6 protein spans the amino acid sequence from region 24-130aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFI6

UniProt

P09912

Expression Region

24-130aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRN Protein Vector (Human) (pPB-C-His)
PV133206 500 ng

SPRN Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
FK506-bp1 Antibody
orb805297 2 mg

FK506-bp1 Antibody

Sign In for Pricing
View Details
NPHS2 (Podocin) (Not for Export EU)
130501 100 µL

NPHS2 (Podocin) (Not for Export EU)

Sign In for Pricing
View Details
RPL21P45 3'UTR GFP Stable Cell Line
TU070951 1.0 mL

RPL21P45 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2- (4-Fluorophenoxy) imidazo[1,2-a]pyridine-3-carbaldehyde
GWB13166-01 50 mg

2- (4-Fluorophenoxy) imidazo[1,2-a]pyridine-3-carbaldehyde

Sign In for Pricing
View Details
2- (4-Fluorophenoxy) imidazo[1,2-a]pyridine-3-carbaldehyde
GWB13166-02 0.5 g

2- (4-Fluorophenoxy) imidazo[1,2-a]pyridine-3-carbaldehyde

Sign In for Pricing
View Details