Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IDUA protein

This Human IDUA protein spans the amino acid sequence from region 28-653aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IDUA

UniProt

P35475

Expression Region

28-653aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cstb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6853008 1.0 µg DNA

Cstb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Carboxylesterase 1 (CES1) Peptide
abx615469 100 µg

Carboxylesterase 1 (CES1) Peptide

Sign In for Pricing
View Details
NPAS4 CRISPR/Cas9 KO Plasmid (h2)
sc-402373-KO-2 20 µg

NPAS4 CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details
USP22 Polyclonal Antibody
MBS8572239-01 0.1 mL

USP22 Polyclonal Antibody

Sign In for Pricing
View Details
USP22 Polyclonal Antibody
MBS8572239-02 0.1 mL (AF405L)

USP22 Polyclonal Antibody

Sign In for Pricing
View Details
USP22 Polyclonal Antibody
MBS8572239-03 0.1 mL (AF405S)

USP22 Polyclonal Antibody

Sign In for Pricing
View Details