Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ICA1 protein

This Human ICA1 protein spans the amino acid sequence from region 1-268aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ICA1

UniProt

Q05084

Expression Region

1-268aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (CLIP/813), CF647 conjugate, 0.1mg/mL
BNC470813-100 1x 100 µL

CD74 (CLIP/813), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAG5 (NM_001015048) Human Over-expression Lysate
LY423114 100 µg

BAG5 (NM_001015048) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IL-18 Antibody Pair Set
E-KAB-0042 50 µL & 100 µg

Human IL-18 Antibody Pair Set

Sign In for Pricing
View Details
GSPT1 (NM_002094) Human Over-expression Lysate
LC432333 20 µg

GSPT1 (NM_002094) Human Over-expression Lysate

Sign In for Pricing
View Details
Influenza A [A/Darwin/9/2021 (H3N2) ] Neuraminidase (NA) Protein, His Tag (MALS & SPR verified)
NE2-V5249-1mg 1 mg

Influenza A [A/Darwin/9/2021 (H3N2) ] Neuraminidase (NA) Protein, His Tag (MALS & SPR verified)

Sign In for Pricing
View Details
Mouse HGF Antibody Pair Set
E-KAB-0338 50 µL & 100 µg

Mouse HGF Antibody Pair Set

Sign In for Pricing
View Details