Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HSD11B2 protein

This Human HSD11B2 protein spans the amino acid sequence from region 1-405aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HSD11B2

UniProt

P80365

Expression Region

1-405aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smoothelin (SMTN) BioAssayTM ELISA Kit (Human)
028114 96 Tests

Smoothelin (SMTN) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Securin (PTTG1) Human qPCR Primer Pair (NM_004219)
HP207568 200 Reactions

Securin (PTTG1) Human qPCR Primer Pair (NM_004219)

Sign In for Pricing
View Details
TP53I13 Rabbit Polyclonal Antibody (BF594)
orb2403052 100 µL

TP53I13 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
CD58 Human, Sf9
OM300611-01 10 µg

CD58 Human, Sf9

Sign In for Pricing
View Details
CD58 Human, Sf9
OM300611-02 2 µg

CD58 Human, Sf9

Sign In for Pricing
View Details
CD58 Human, Sf9
OM300611-03 1 mg

CD58 Human, Sf9

Sign In for Pricing
View Details