Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hba protein

This Mouse Hba protein spans the amino acid sequence from region 2-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hba

UniProt

P01942

Expression Region

2-142aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK6 antibody
MBS832830 Inquire

MEK6 antibody

Sign In for Pricing
View Details
Gm14474 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3761605 3x 1.0 µg

Gm14474 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
MIA3 siRNA (Mouse)
MBS8233266-01 15 nmol

MIA3 siRNA (Mouse)

Sign In for Pricing
View Details
MIA3 siRNA (Mouse)
MBS8233266-02 30 nmol

MIA3 siRNA (Mouse)

Sign In for Pricing
View Details
MIA3 siRNA (Mouse)
MBS8233266-03 5x 30 nmol

MIA3 siRNA (Mouse)

Sign In for Pricing
View Details
Goat Angiotensinase A ELISA Kit
MBS750713-01 48 Well

Goat Angiotensinase A ELISA Kit

Sign In for Pricing
View Details