Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hba protein

This Mouse Hba protein spans the amino acid sequence from region 2-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hba

UniProt

P01942

Expression Region

2-142aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOK Antibody - N-terminal region
OAAB12209-400UL 400 µL

BOK Antibody - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal HPV16/HPV18 E6 Antibody (HPV16/1295 + HPV18/1297) [Alexa Fluor 350]
NBP3-08500AF350 100 µL

Mouse Monoclonal HPV16/HPV18 E6 Antibody (HPV16/1295 + HPV18/1297) [Alexa Fluor 350]

Sign In for Pricing
View Details
Tmem91 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3172603 1.0 µg DNA

Tmem91 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Hypoxia-inducible factor 1-alpha inhibitor, HIF1AN ELISA Kit
MBS9304681-01 48 Well

Mouse Hypoxia-inducible factor 1-alpha inhibitor, HIF1AN ELISA Kit

Sign In for Pricing
View Details
Mouse Hypoxia-inducible factor 1-alpha inhibitor, HIF1AN ELISA Kit
MBS9304681-02 96 Well

Mouse Hypoxia-inducible factor 1-alpha inhibitor, HIF1AN ELISA Kit

Sign In for Pricing
View Details
Mouse Hypoxia-inducible factor 1-alpha inhibitor, HIF1AN ELISA Kit
MBS9304681-03 5x 96 Well

Mouse Hypoxia-inducible factor 1-alpha inhibitor, HIF1AN ELISA Kit

Sign In for Pricing
View Details