Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFR1 protein

This Human TNFR1 protein spans the amino acid sequence from region 31-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD120a Protein, FPF Protein, MGC19588 Protein, p55 Protein, p55-R Protein, p60 Protein, TBP1 Protein, TBPI Protein, TNF R Protein, TNF R55 Protein, TNF-R1 Protein, TNF-RI Protein, TNFAR Protein, TNFR-I Protein, TNFR1 Protein, TNFR55 Protein, TNFR60 Protein, TNFRI Protein, TNFRSF1a Protein, TNR1A_HUMAN Protein, Tumor necrosis factor receptor 1 Protein, Tumor necrosis factor receptor superfamily, member 1A Protein, Tumor necrosis factor receptor type 1 Protein, Tumor necrosis factor receptor type I Protein, Tumor necrosis factor-binding protein 1 Protein

UniProt

P19438

Expression Region

31-210aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRA1 shRNA Plasmid (m)
sc-152434-SH 20 µg

PRA1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Anti-PDIA6 (Recombinant Rabbit, Monoclonal, IgG)
A118507 100 µL

Anti-PDIA6 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
Neuro D (A-10) FITC
sc-46684 FITC 200 µg/mL

Neuro D (A-10) FITC

Sign In for Pricing
View Details
Gemin 1 (SMN2) (NM_022876) Human Recombinant Protein
TP321156M 100 µg

Gemin 1 (SMN2) (NM_022876) Human Recombinant Protein

Sign In for Pricing
View Details
VEGFR-2-IN-45
orb3134330-01 50 mg

VEGFR-2-IN-45

Sign In for Pricing
View Details
VEGFR-2-IN-45
orb3134330-02 10 mg

VEGFR-2-IN-45

Sign In for Pricing
View Details