Human TNFR1 protein

CD120a Protein, FPF Protein, MGC19588 Protein, p55 Protein, p55-R Protein, p60 Protein, TBP1 Protein, TBPI Protein, TNF R Protein, TNF R55 Protein, TNF-R1 Protein, TNF-RI Protein, TNFAR Protein, TNFR-I Protein, TNFR1 Protein, TNFR55 Protein, TNFR60 Protein, TNFRI Protein, TNFRSF1a Protein, TNR1A_HUMAN Protein, Tumor necrosis factor receptor 1 Protein, Tumor necrosis factor receptor superfamily, member 1A Protein, Tumor necrosis factor receptor type 1 Protein, Tumor necrosis factor receptor type I Protein, Tumor necrosis factor-binding protein 1 Protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT