Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Guca2b protein

This Mouse Guca2b protein spans the amino acid sequence from region 22-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Guca2b

UniProt

O09051

Expression Region

22-106aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM5 (RNA-binding Protein 5, RNA-binding Motif Protein 5, Putative Tumor Suppressor LUCA15, Protein G15, Renal Carcinoma Antigen NY-REN-9, H37, LUCA15) APC
MBS6392145-01 0.1 mL

RBM5 (RNA-binding Protein 5, RNA-binding Motif Protein 5, Putative Tumor Suppressor LUCA15, Protein G15, Renal Carcinoma Antigen NY-REN-9, H37, LUCA15) APC

Sign In for Pricing
View Details
RBM5 (RNA-binding Protein 5, RNA-binding Motif Protein 5, Putative Tumor Suppressor LUCA15, Protein G15, Renal Carcinoma Antigen NY-REN-9, H37, LUCA15) APC
MBS6392145-02 5x 0.1 mL

RBM5 (RNA-binding Protein 5, RNA-binding Motif Protein 5, Putative Tumor Suppressor LUCA15, Protein G15, Renal Carcinoma Antigen NY-REN-9, H37, LUCA15) APC

Sign In for Pricing
View Details
Spermine synthase Recombinant Antibody, APC-Cy7 Conjugated
bsm-62532R-APC-Cy7 100 µL

Spermine synthase Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
IFABP Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62307R-BF555 100 µL

IFABP Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
GIPC (GIPC1) Human Over-expression Lysate
orb1375739 20 µg

GIPC (GIPC1) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Protein hairless (HR) ELISA Kit
MBS287061-01 48 Tests

Human Protein hairless (HR) ELISA Kit

Sign In for Pricing
View Details