Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Guca2b protein

This Mouse Guca2b protein spans the amino acid sequence from region 22-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Guca2b

UniProt

O09051

Expression Region

22-106aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Syntrophobacter fumaroxidans Protein translocase subunit SecD (secD)
orb2909052-01 20 µg

Recombinant Syntrophobacter fumaroxidans Protein translocase subunit SecD (secD)

Sign In for Pricing
View Details
Recombinant Syntrophobacter fumaroxidans Protein translocase subunit SecD (secD)
orb2909052-02 100 µg

Recombinant Syntrophobacter fumaroxidans Protein translocase subunit SecD (secD)

Sign In for Pricing
View Details
Canine Muscarinic acetylcholine receptor M3 ELISA Kit
MBS736414-01 48 Well

Canine Muscarinic acetylcholine receptor M3 ELISA Kit

Sign In for Pricing
View Details
Canine Muscarinic acetylcholine receptor M3 ELISA Kit
MBS736414-02 96 Well

Canine Muscarinic acetylcholine receptor M3 ELISA Kit

Sign In for Pricing
View Details
Canine Muscarinic acetylcholine receptor M3 ELISA Kit
MBS736414-03 5x 96 Well

Canine Muscarinic acetylcholine receptor M3 ELISA Kit

Sign In for Pricing
View Details
Canine Muscarinic acetylcholine receptor M3 ELISA Kit
MBS736414-04 10x 96 Well

Canine Muscarinic acetylcholine receptor M3 ELISA Kit

Sign In for Pricing
View Details