Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OB protein

This Human OB protein spans the amino acid sequence from region 29-164aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OB, OBS

UniProt

P41159

Expression Region

29-164aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFRα mouse Monoclonal Antibody (4G11)
RA11826-01 50 µL

PDGFRα mouse Monoclonal Antibody (4G11)

Sign In for Pricing
View Details
PDGFRα mouse Monoclonal Antibody (4G11)
RA11826-02 100 µL

PDGFRα mouse Monoclonal Antibody (4G11)

Sign In for Pricing
View Details
Porcine Neutrophil Activating Protein-2 ELISA Kit
MBS038480-01 48 Well

Porcine Neutrophil Activating Protein-2 ELISA Kit

Sign In for Pricing
View Details
Porcine Neutrophil Activating Protein-2 ELISA Kit
MBS038480-02 96 Well

Porcine Neutrophil Activating Protein-2 ELISA Kit

Sign In for Pricing
View Details
Porcine Neutrophil Activating Protein-2 ELISA Kit
MBS038480-03 5x 96 Well

Porcine Neutrophil Activating Protein-2 ELISA Kit

Sign In for Pricing
View Details
Porcine Neutrophil Activating Protein-2 ELISA Kit
MBS038480-04 10x 96 Well

Porcine Neutrophil Activating Protein-2 ELISA Kit

Sign In for Pricing
View Details