Mouse Gcgr protein
This Mouse Gcgr protein spans the amino acid sequence from region 27-143aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Gcgr
UniProt
Q61606
Expression Region
27-143aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Mus musculus (Mouse)
Field of Research
Epigenetics, GPCR, Neuroscience, Signaling Pathways
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
15.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
032460 200 µL
BCL11A, CT (BCL11A, CTIP1, EVI9, KIAA1809, ZNF856, B Cell lymphoma/leukemia 11A, B Cell CLL/lymphoma 11A, COUP-TF-interacting protein 1, Ecotropic viral integration site 9 protein homolog, Zinc finger protein 856)
Sign In for Pricing
View Details 
MBS6403837-01 0.1 mL
CCL7 (MCP3, SCYA6, SCYA7, C-C motif Chemokine 7, Monocyte Chemoattractant Protein 3, Monocyte Chemotactic Protein 3, NC28, Small-inducible Cytokine A7, MGC138463, MGC138465, MCP-3) (MaxLight 550)
Sign In for Pricing
View Details MBS6403837-02 5x 0.1 mL
CCL7 (MCP3, SCYA6, SCYA7, C-C motif Chemokine 7, Monocyte Chemoattractant Protein 3, Monocyte Chemotactic Protein 3, NC28, Small-inducible Cytokine A7, MGC138463, MGC138465, MCP-3) (MaxLight 550)
Sign In for Pricing
View Details