Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Glucagon protein

This Human Glucagon protein spans the amino acid sequence from region 53-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GCG Proteins, GLP 2 Proteins, Glucagon like peptide 2 Proteins, GRPP Proteins, Glucagon protein

UniProt

P01275

Expression Region

53-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ATG7 Protein, N-His
MBS1576607-01 0.1 mg

Recombinant Human ATG7 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ATG7 Protein, N-His
MBS1576607-02 1 mg

Recombinant Human ATG7 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ATG7 Protein, N-His
MBS1576607-03 5x 1 mg

Recombinant Human ATG7 Protein, N-His

Sign In for Pricing
View Details
PPP4C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV691454 1.0 µg DNA

PPP4C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
NDUFB3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
31643151 3x 1.0 µg DNA

NDUFB3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
PKN1/2 (pT774/816) Blocking Peptide
CBP5781-01 1 mg

PKN1/2 (pT774/816) Blocking Peptide

Sign In for Pricing
View Details