Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FPGT protein

This Human FPGT protein spans the amino acid sequence from region 1-594aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FPGT

UniProt

O14772

Expression Region

1-594aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pla2g4b (NM_001107764) Rat Tagged Lenti ORF Clone
RR208014L3 10 µg

Pla2g4b (NM_001107764) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TMEM200C Recombinant Protein Antigen
NBP2-30818PEP 0.1 mL

TMEM200C Recombinant Protein Antigen

Sign In for Pricing
View Details
HNRNPU Rabbit Polyclonal Antibody
E10G05495 100 µL

HNRNPU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Sheep Transcription factor SOX-2 (SOX2)
MBS951095-01 0.02 mg (E-Coli)

Recombinant Sheep Transcription factor SOX-2 (SOX2)

Sign In for Pricing
View Details
Recombinant Sheep Transcription factor SOX-2 (SOX2)
MBS951095-02 0.02 mg (Yeast)

Recombinant Sheep Transcription factor SOX-2 (SOX2)

Sign In for Pricing
View Details
Recombinant Sheep Transcription factor SOX-2 (SOX2)
MBS951095-03 0.1 mg (E-Coli)

Recombinant Sheep Transcription factor SOX-2 (SOX2)

Sign In for Pricing
View Details