Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FPGT protein

This Human FPGT protein spans the amino acid sequence from region 1-594aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FPGT

UniProt

O14772

Expression Region

1-594aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS36 (NM_173502) Human Tagged ORF Clone Lentiviral Particle
RC221435L4V 200 µL

PRSS36 (NM_173502) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hamster Phospho-Protein Phosphatase 1 Regulatory Subunit 1B (PDARPP32-T75) ELISA Kit
MBS9935616-01 48 Well

Hamster Phospho-Protein Phosphatase 1 Regulatory Subunit 1B (PDARPP32-T75) ELISA Kit

Sign In for Pricing
View Details
Hamster Phospho-Protein Phosphatase 1 Regulatory Subunit 1B (PDARPP32-T75) ELISA Kit
MBS9935616-02 96 Well

Hamster Phospho-Protein Phosphatase 1 Regulatory Subunit 1B (PDARPP32-T75) ELISA Kit

Sign In for Pricing
View Details
Hamster Phospho-Protein Phosphatase 1 Regulatory Subunit 1B (PDARPP32-T75) ELISA Kit
MBS9935616-03 5x 96 Well

Hamster Phospho-Protein Phosphatase 1 Regulatory Subunit 1B (PDARPP32-T75) ELISA Kit

Sign In for Pricing
View Details
Hamster Phospho-Protein Phosphatase 1 Regulatory Subunit 1B (PDARPP32-T75) ELISA Kit
MBS9935616-04 10x 96 Well

Hamster Phospho-Protein Phosphatase 1 Regulatory Subunit 1B (PDARPP32-T75) ELISA Kit

Sign In for Pricing
View Details
Anti-SCP-2 SYCP2 Antibody
A11028 100 µL

Anti-SCP-2 SYCP2 Antibody

Sign In for Pricing
View Details